General Information

  • ID:  hor006274
  • Uniprot ID:  Q28358(95-109)
  • Protein name:  Uroguanylin
  • Gene name:  GUCA2B
  • Organism:  Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana)
  • Family:  Guanylin family
  • Source:  animal
  • Expression:  Small and large intestine and atria and ventricles of heart. Both uroguanylin and prouroguanylin are found in plasma.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Didelphis (genus), Didelphinae (subfamily), Didelphidae (family), Didelphimorphia (order), Metatheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030250 guanylate cyclase activator activity
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QEDCELCINVACTGC
  • Length:  15(95-109)
  • Propeptide:  MKVLALPVAVAAMLLVLAQNTQSVYIQYEGFQVKLDSVKKLDELLEQPRSFRHRMGTQRDPSVLCSDPALPSDLQPVCENSQAANIFRALRSISQEDCELCINVACTGC
  • Signal peptide:  MKVLALPVAVAAMLLVLAQNTQS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an auto
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-12; 7-15
  • Structure ID:  AF-Q28358-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006274_AF2.pdbhor006274_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 185074 Formula: C61H101N17O25S4
Absent amino acids: FHKMPRSWY Common amino acids: C
pI: 3.42 Basic residues: 0
Polar residues: 7 Hydrophobic residues: 4
Hydrophobicity: 38 Boman Index: -1534
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 8038 Extinction Coefficient cystines: 250
Absorbance 280nm: 17.86

Literature

  • PubMed ID:  8605009
  • Title:  Uroguanylin: cloning of preprouroguanylin cDNA, mRNA expression in the intestine and heart and isolation of uroguanylin and prouroguanylin from plasma.
  • PubMed ID:  7902563
  • Title:  Uroguanylin: structure and activity of a second endogenous peptide that stimulates intestinal guanylat